PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA13G00112
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 332aa    MW: 38952.8 Da    PI: 6.7429
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA13G00112genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.15.3e-151462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W+++Ed +l+ ++++ G+g +W + ++++g++R++k+c++rw++yl
       AA13G00112 14 KGPWSPDEDIKLKSYIEKNGTGgNWIALPHKIGLKRCGKSCRLRWLNYL 62
                     79*********************************************97 PP

2Myb_DNA-binding36.98.3e-1269111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +++eE+ ++ ++    G++ W+ Ia+ ++ gRt++++k++w++
       AA13G00112  69 GGFSEEEEIIICNLYVTIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                      569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.004962IPR017930Myb domain
SuperFamilySSF466892.46E-2511109IPR009057Homeodomain-like
SMARTSM007172.8E-111364IPR001005SANT/Myb domain
PfamPF002492.3E-141462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.1E-221569IPR009057Homeodomain-like
CDDcd001674.44E-71662No hitNo description
PROSITE profilePS5129419.88463117IPR017930Myb domain
SMARTSM007171.2E-1067115IPR001005SANT/Myb domain
PfamPF002492.1E-1069111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-2270118IPR009057Homeodomain-like
CDDcd001671.88E-671113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MGRAPCCDKA NVKKGPWSPD EDIKLKSYIE KNGTGGNWIA LPHKIGLKRC GKSCRLRWLN  60
YLRPNLKHGG FSEEEEIIIC NLYVTIGSRW SIIAAQLPGR TDNDIKNYWN TKLKKKLINK  120
QRKELQEACR GQQEMFATMK NQRQQNKHLF GEINVDQDTF MMRQDQTTMF TWPLHHHDQH  180
HHNDQHHHQN DQIQSLTKSF QDQEEIKQSV MVKIENQESK NLDSFDHLSC FQESEIFNTN  240
NPAIEQAIIA KIGENIDYQY CQQQQQQQQQ QFLHQWLGNF ESETITDLFL NNLNPYENLE  300
IVTPSMDTET MKSTSRDQSS LSWEDIKLSC LL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-21141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010503634.11e-117PREDICTED: transcription factor RAX3-like
SwissprotQ9M2Y91e-107RAX3_ARATH; Transcription factor RAX3
TrEMBLA0A0D3DRN61e-114A0A0D3DRN6_BRAOL; Uncharacterized protein
STRINGBra017963.1-P1e-108(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM29412568
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49690.11e-91myb domain protein 84